PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000772.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 447aa    MW: 50665.5 Da    PI: 8.7514
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000772.1_g00020.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR128.84.1e-09345386143
                     FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkree 43 
                              kfY++Y + vGF+vr s+ kks r++ei  + +vCs+eg+++ 
  Itr_sc000772.1_g00020.1 345 KFYRQYTRVVGFDVRHSTVKKS-RDDEIALKYMVCSREGFKNA 386
                              6******************999.6666999**********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR016272.8E-8855267IPR006514IRX15/IRX15L/IGXM
PfamPF046698.4E-6978261IPR021148Polysaccharide biosynthesis domain
PfamPF031013.5E-6345386IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045492Biological Processxylan biosynthetic process
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MSRPKTQNAI TNLKLMIIVC SFLFMAVMVL IRSNVTISSS PNPICPTPTE ECNKISPSLA  60
NALVHYATSN ITPQQTLKEI SVSLRILDKK SPCNFLVFGL GHDSLMWSAL NHGGRTVFLE  120
EDKSWIDQIR RRVPSLESYH VRYDSKVSRA KELMGIGMGI ECREVVDPRA SKCGLAIKNL  180
PDEVYEVDWD VIMVDAPTGY HDEAPGRMNA IYTAGLMARN RENGETDVLV HDVDRVVENK  240
FSKAFLCEGY FVEEEGRIRH FTVPSHRVRL GRPFSFVGVR WFMRARLIRK GYCALVRVKW  300
CIISGVGGMQ MEISSGSTKY WCPEHDDAIK SQVRQCYNTL EDKVKFYRQY TRVVGFDVRH  360
STVKKSRDDE IALKYMVCSR EGFKNAAMVM PNIGDGDVVG SIMQKRCMIS NRVGDKPKKG  420
ATNVDLWNFK CDLQEYIING DAHSCSK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526403.11e-139PREDICTED: glucuronoxylan 4-O-methyltransferase 3
SwissprotQ9T0F71e-119GXM2_ARATH; Glucuronoxylan 4-O-methyltransferase 2
TrEMBLB9SK841e-139B9SK84_RICCO; Putative uncharacterized protein
STRINGVIT_00s0238g00020.t011e-133(Vitis vinifera)